Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.53: Resolvase-like [53040] (2 superfamilies) Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest |
Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families) |
Family c.53.2.1: beta-carbonic anhydrase, cab [53057] (2 proteins) |
Protein beta-carbonic anhydrase [53058] (4 species) |
Species Red alga (Porphyridium purpureum) [TaxId:35688] [53060] (1 PDB entry) duplication: consists of two similar domains |
Domain d1ddzb2: 1ddz B:326-564 [33375] complexed with zn |
PDB Entry: 1ddz (more details), 2.2 Å
SCOPe Domain Sequences for d1ddzb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ddzb2 c.53.2.1 (B:326-564) beta-carbonic anhydrase {Red alga (Porphyridium purpureum) [TaxId: 35688]} npnaplvqvtkggeseldstmekltaelvqqtpgklkeganrvfvnnenwrqkmlkqdpq ffsnlahtqtpeilwigcadsrvpanqiinlpagevfvhrnianqcihsdmsflsvlqya vqylkvkrvvvcghyacggcaaalgdsrlglidnwlrhirdvrrhnqaelsritdpkdsl nrlieinvleqmhnvcatsivqdawdagqelevqgvvygvgdgklrdmgvvakanddig
Timeline for d1ddzb2: