Lineage for d5jnaa_ (5jna A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2401367Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2401368Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2401369Family b.74.1.1: Carbonic anhydrase [51070] (2 protein domains)
    automatically mapped to Pfam PF00194
  6. 2401370Protein Carbonic anhydrase [51071] (10 species)
  7. 2402119Species Human (Homo sapiens), isozyme IV [TaxId:9606] [51076] (10 PDB entries)
  8. 2402136Domain d5jnaa_: 5jna A: [333742]
    automated match to d1znca_
    complexed with act, gol, so4, tor, zn

Details for d5jnaa_

PDB Entry: 5jna (more details), 2 Å

PDB Description: crystal structure for the complex of human carbonic anhydrase iv and topiramate
PDB Compounds: (A:) Carbonic anhydrase 4

SCOPe Domain Sequences for d5jnaa_:

Sequence, based on SEQRES records: (download)

>d5jnaa_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), isozyme IV [TaxId: 9606]}
aeshwcyevqaessnypclvpvkwggncqkdrqspinivttkakvdkklgrfffsgydkk
qtwtvqnnghsvmmllenkasisggglpapyqakqlhlhwsdlpykgsehsldgehfame
mhivhekekgtsrnvkeaqdpedeiavlaflveagtqvnegfqplvealsnipkpemstt
maesslldllpkeeklrhyfrylgslttptcdekvvwtvfrepiqlhreqilafsqklyy
dkeqtvsmkdnvrplqqlgqrtviks

Sequence, based on observed residues (ATOM records): (download)

>d5jnaa_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), isozyme IV [TaxId: 9606]}
aeshwcyevqaessnypclvpvkwggncqkdrqspinivttkakvdkklgrfffsgydkk
qtwtvqnnghsvmmllenkasisggglpapyqakqlhlhwsdlpykgsehsldgehfame
mhivhekekgtsdpedeiavlaflveagtqvnegfqplvealsnipkpemsttmaessll
dllpkeeklrhyfrylgslttptcdekvvwtvfrepiqlhreqilafsqklyydkeqtvs
mkdnvrplqqlgqrtviks

SCOPe Domain Coordinates for d5jnaa_:

Click to download the PDB-style file with coordinates for d5jnaa_.
(The format of our PDB-style files is described here.)

Timeline for d5jnaa_: