Lineage for d1ddza2 (1ddz A:326-564)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 71718Fold c.53: Resolvase-like [53040] (2 superfamilies)
  4. 71754Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (1 family) (S)
  5. 71755Family c.53.2.1: beta-carbonic anhydrase, cab [53057] (1 protein)
  6. 71756Protein beta-carbonic anhydrase [53058] (4 species)
  7. 71777Species Red alga (Porphyridium purpureum) [TaxId:35688] [53060] (1 PDB entry)
  8. 71779Domain d1ddza2: 1ddz A:326-564 [33373]

Details for d1ddza2

PDB Entry: 1ddz (more details), 2.2 Å

PDB Description: x-ray structure of a beta-carbonic anhydrase from the red alga, porphyridium purpureum r-1

SCOP Domain Sequences for d1ddza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ddza2 c.53.2.1 (A:326-564) beta-carbonic anhydrase {Red alga (Porphyridium purpureum)}
npnaplvqvtkggeseldstmekltaelvqqtpgklkeganrvfvnnenwrqkmlkqdpq
ffsnlahtqtpeilwigcadsrvpanqiinlpagevfvhrnianqcihsdmsflsvlqya
vqylkvkrvvvcghyacggcaaalgdsrlglidnwlrhirdvrrhnqaelsritdpkdsl
nrlieinvleqmhnvcatsivqdawdagqelevqgvvygvgdgklrdmgvvakanddig

SCOP Domain Coordinates for d1ddza2:

Click to download the PDB-style file with coordinates for d1ddza2.
(The format of our PDB-style files is described here.)

Timeline for d1ddza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ddza1