Class a: All alpha proteins [46456] (289 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.0: automated matches [191420] (1 protein) not a true family |
Protein automated matches [190590] (26 species) not a true protein |
Species Acipenser stellatus [TaxId:7903] [333724] (2 PDB entries) |
Domain d5jnzb_: 5jnz B: [333725] automated match to d1spgb_ complexed with gol, hem |
PDB Entry: 5jnz (more details), 2.2 Å
SCOPe Domain Sequences for d5jnzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jnzb_ a.1.1.0 (B:) automated matches {Acipenser stellatus [TaxId: 7903]} vkwtdserfaivtlwakvdvervgaqalvrllvvypwtqryfgafgnisdaaaiagnakv hahgktvlssvgiaiahmddlagaftalstfhtetlhvdpdnfqhfgdclsivlaatfgt aytpdvhaawqkmiaviisalskeyh
Timeline for d5jnzb_: