Lineage for d5jnzb_ (5jnz B:)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies)
core: 6 helices; folded leaf, partly openedSuperfamily a.1.1: Globin-like [46458] (5 families) 
Family a.1.1.0: automated matches [191420] (1 protein)
not a true familyProtein automated matches [190590] (26 species)
not a true protein
Species Acipenser stellatus [TaxId:7903] [333724] (2 PDB entries) 
Domain d5jnzb_: 5jnz B: [333725]
automated match to d1spgb_
complexed with gol, hem
Details for d5jnzb_
PDB Entry: 5jnz (more details), 2.2 Å
PDB Description: x-ray sequence and high resolution crystal structure of starry sturgeon methemoglobin
PDB Compounds: (B:) Beta chainSCOPe Domain Sequences for d5jnzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jnzb_ a.1.1.0 (B:) automated matches {Acipenser stellatus [TaxId: 7903]}
vkwtdserfaivtlwakvdvervgaqalvrllvvypwtqryfgafgnisdaaaiagnakv
hahgktvlssvgiaiahmddlagaftalstfhtetlhvdpdnfqhfgdclsivlaatfgt
aytpdvhaawqkmiaviisalskeyh
SCOPe Domain Coordinates for d5jnzb_:
Click to download the PDB-style file with coordinates for d5jnzb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5jnzb_:
- d5jnzb_ first appeared in SCOPe 2.06
- d5jnzb_ does not appear in SCOPe 2.08
View in 3D
