Lineage for d1ddza1 (1ddz A:84-325)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24949Fold c.53: Resolvase-like [53040] (2 superfamilies)
  4. 24984Superfamily c.53.2: beta-carbonic anhydrase [53056] (1 family) (S)
  5. 24985Family c.53.2.1: beta-carbonic anhydrase [53057] (1 protein)
  6. 24986Protein beta-carbonic anhydrase [53058] (2 species)
  7. 24996Species Red alga (Porphyridium purpureum) [TaxId:35688] [53060] (1 PDB entry)
  8. 24997Domain d1ddza1: 1ddz A:84-325 [33372]

Details for d1ddza1

PDB Entry: 1ddz (more details), 2.2 Å

PDB Description: x-ray structure of a beta-carbonic anhydrase from the red alga, porphyridium purpureum r-1

SCOP Domain Sequences for d1ddza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ddza1 c.53.2.1 (A:84-325) beta-carbonic anhydrase {Red alga (Porphyridium purpureum)}
vmsdlekkfieleaklvaqpagqampgksnifanneawrqemlkqdpeffnrlangqspe
ylwigcadsrvpanqlldlpagevfvhrnianqcihsdisflsvlqyavqylkvkhilvc
ghygcggakaalgdsrlglidnwlrhirdvrrmnakyldkckdgdeelnrlielnvleqv
hnvcatsivqdawdagqeltvqgvvygvgdgklrdlgvvvnssddiskfyrtksdsgalk
ag

SCOP Domain Coordinates for d1ddza1:

Click to download the PDB-style file with coordinates for d1ddza1.
(The format of our PDB-style files is described here.)

Timeline for d1ddza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ddza2