Lineage for d5hbtc2 (5hbt C:107-212)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2753398Species Norway rat (Rattus norvegicus) [TaxId:10116] [262079] (6 PDB entries)
  8. 2753409Domain d5hbtc2: 5hbt C:107-212 [333718]
    Other proteins in same PDB: d5hbta_, d5hbtb1, d5hbtb2, d5hbtc1
    automated match to d1c5da2

Details for d5hbtc2

PDB Entry: 5hbt (more details), 2.61 Å

PDB Description: complex structure of fab35 and human nachr alpha1
PDB Compounds: (C:) Fab35, Light Chain

SCOPe Domain Sequences for d5hbtc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hbtc2 b.1.1.2 (C:107-212) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
radaaptvsifppsteqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqd
skdstysmsstlsltkadyeshnlytcevvhktssspvvksfnrne

SCOPe Domain Coordinates for d5hbtc2:

Click to download the PDB-style file with coordinates for d5hbtc2.
(The format of our PDB-style files is described here.)

Timeline for d5hbtc2: