SCOPe 2.08: Domain d5hbtc2: 5hbt C:107-212

Lineage for d5hbtc2 (5hbt C:107-212)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [262079] (6 PDB entries)

8. Domain d5hbtc2: 5hbt C:107-212 [333718]
   Other proteins in same PDB: d5hbta_, d5hbtb1, d5hbtb2, d5hbtc1
   automated match to d1c5da2

Details for d5hbtc2

PDB Entry: 5hbt, 2.61 Å

PDB Description: complex structure of fab35 and human nachr alpha1

PDB Compounds: (C:) Fab35, Light Chain

SCOPe Domain Sequences for d5hbtc2:

Sequence; same for both SEQRES and ATOM records:

>d5hbtc2 b.1.1.2 (C:107-212) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
radaaptvsifppsteqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqd
skdstysmsstlsltkadyeshnlytcevvhktssspvvksfnrne

Timeline for d5hbtc2:

• d5hbtc2 first appeared in SCOPe 2.06
  
• d5hbtc2 appears in SCOPe 2.07