SCOPe 2.08: Domain d5hbtc1: 5hbt C:1-106

Lineage for d5hbtc1 (5hbt C:1-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [225064] (19 PDB entries)

8. Domain d5hbtc1: 5hbt C:1-106 [333717]
   Other proteins in same PDB: d5hbta_, d5hbtb1, d5hbtb2, d5hbtc2
   automated match to d1c5da1

Details for d5hbtc1

PDB Entry: 5hbt, 2.61 Å

PDB Description: complex structure of fab35 and human nachr alpha1

PDB Compounds: (C:) Fab35, Light Chain

SCOPe Domain Sequences for d5hbtc1:

Sequence; same for both SEQRES and ATOM records:

>d5hbtc1 b.1.1.0 (C:1-106) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
divitqspsllsasvgdrvtltckgsqnidnylawyqqklgeapklliyktnslqtgips
rfsgsgsgtdytltisslhsedlatyycyqyingytfgtgtklelk

Timeline for d5hbtc1:

• d5hbtc1 first appeared in SCOPe 2.06
  
• d5hbtc1 appears in SCOPe 2.07