Lineage for d5huta_ (5hut A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2910507Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2910508Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2911058Family c.87.1.0: automated matches [191559] (1 protein)
    not a true family
  6. 2911059Protein automated matches [190965] (40 species)
    not a true protein
  7. 2911094Species Candida albicans [TaxId:237561] [333712] (4 PDB entries)
  8. 2911097Domain d5huta_: 5hut A: [333713]
    automated match to d2wtxb_
    complexed with 1pe, na, so4, upg

Details for d5huta_

PDB Entry: 5hut (more details), 1.9 Å

PDB Description: structure of candida albicans trehalose-6-phosphate synthase in complex with udp-glucose
PDB Compounds: (A:) Alpha,alpha-trehalose-phosphate synthase [UDP-forming]

SCOPe Domain Sequences for d5huta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5huta_ c.87.1.0 (A:) automated matches {Candida albicans [TaxId: 237561]}
gkvlvvsnripvtikrldngsydysmssgglvtalqglkkttefqwygwpgleipedeqt
kvndelkskfnctaiflsdtiadlhyngfsnsilwplfhyhpgemnfdenawaayieank
kfaleivkqvndddmiwvhdyhlmllpemlrqeignkkknikigfflhtpfpsseiyril
pvrkeilegvlscdligfhtydyarhfissvsrivpnvstlpngikyqgrsisigafpig
idvdnfidglkkdsvverikqlkskfkdvkvivgvdrldyikgvpqklhafevflnenpe
wigkvvlvqvavpsrgdveeyqslrstvselvgringefgtvefvpihylhksipfdeli
slynisdvclvsstrdgmnlvsyeyiacqqdrkgvlilsefagaaqslngalivnpwnte
dlseaikesltlpeekrefnfkklftyiskytsgfwgesfvkelykcnp

SCOPe Domain Coordinates for d5huta_:

Click to download the PDB-style file with coordinates for d5huta_.
(The format of our PDB-style files is described here.)

Timeline for d5huta_: