Lineage for d5hbtb1 (5hbt B:1-211)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2819475Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2819476Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2819945Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 2819946Protein automated matches [193506] (5 species)
    not a true protein
  7. 2820444Species Human (Homo sapiens) [TaxId:9606] [259757] (10 PDB entries)
  8. 2820473Domain d5hbtb1: 5hbt B:1-211 [333710]
    Other proteins in same PDB: d5hbta_, d5hbtb2, d5hbtc1, d5hbtc2
    automated match to d4uxua_

Details for d5hbtb1

PDB Entry: 5hbt (more details), 2.61 Å

PDB Description: complex structure of fab35 and human nachr alpha1
PDB Compounds: (B:) Acetylcholine receptor subunit alpha 1

SCOPe Domain Sequences for d5hbtb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hbtb1 b.96.1.0 (B:1-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sehetrleaklfkdyssvvrpvedhrqvvevtvglqliqlinvdevnqivttnvrlkqqw
vdynlkwnpddyggvkkihipsekiwrpdlvlynnadgdfaivkftkvllqytghitwtp
paifksyceiivthfpfdeqncsmklgtrtydgsavainpesdqpdlsnfmesgewvike
srgwkhsvtysccpdtpyldityhfvmqrlp

SCOPe Domain Coordinates for d5hbtb1:

Click to download the PDB-style file with coordinates for d5hbtb1.
(The format of our PDB-style files is described here.)

Timeline for d5hbtb1: