SCOPe 2.08: Domain d5hbtb1: 5hbt B:1-211

Lineage for d5hbtb1 (5hbt B:1-211)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.0: automated matches [193505] (1 protein)
   not a true family

6. Protein automated matches [193506] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [259757] (10 PDB entries)

8. Domain d5hbtb1: 5hbt B:1-211 [333710]
   Other proteins in same PDB: d5hbta_, d5hbtb2, d5hbtc1, d5hbtc2
   automated match to d4uxua_

Details for d5hbtb1

PDB Entry: 5hbt, 2.61 Å

PDB Description: complex structure of fab35 and human nachr alpha1

PDB Compounds: (B:) Acetylcholine receptor subunit alpha 1

SCOPe Domain Sequences for d5hbtb1:

Sequence; same for both SEQRES and ATOM records:

>d5hbtb1 b.96.1.0 (B:1-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sehetrleaklfkdyssvvrpvedhrqvvevtvglqliqlinvdevnqivttnvrlkqqw
vdynlkwnpddyggvkkihipsekiwrpdlvlynnadgdfaivkftkvllqytghitwtp
paifksyceiivthfpfdeqncsmklgtrtydgsavainpesdqpdlsnfmesgewvike
srgwkhsvtysccpdtpyldityhfvmqrlp

Timeline for d5hbtb1:

• d5hbtb1 first appeared in SCOPe 2.06
  
• d5hbtb1 appears in SCOPe 2.07