SCOPe 2.06: Domain d5fwoa_: 5fwo A:

Lineage for d5fwoa_ (5fwo A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (138 PDB entries)

8. Domain d5fwoa_: 5fwo A: [333704]
   automated match to d4u7sa_

Details for d5fwoa_

PDB Entry: 5fwo, 1.7 Å

PDB Description: llama nanobody porm_130

PDB Compounds: (A:) Nanobody

SCOPe Domain Sequences for d5fwoa_:

Sequence; same for both SEQRES and ATOM records:

>d5fwoa_ b.1.1.1 (A:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesggglvqaggslrlscaasgrtfssyvmgwfrqapgkerefvtaiswsggsihy
adsvkgrftisrdnakntvyllqmnskpedtavytcvagfagygsftsrsardsdkydyw
gqgtkvtvs

Timeline for d5fwoa_:

• d5fwoa_ is new in SCOPe 2.06-stable
  
• d5fwoa_ is called d5fwoa1 in SCOPe 2.07
  
• d5fwoa_ appears in the current release, SCOPe 2.08, called d5fwoa1