Lineage for d5g58a_ (5g58 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2711591Family a.39.1.0: automated matches [191396] (1 protein)
    not a true family
  6. 2711592Protein automated matches [190513] (36 species)
    not a true protein
  7. 2711650Species Human (Homo sapiens) [TaxId:9606] [189519] (58 PDB entries)
  8. 2711699Domain d5g58a_: 5g58 A: [333700]
    automated match to d2d8na_
    complexed with ca; mutant

Details for d5g58a_

PDB Entry: 5g58 (more details), 2.54 Å

PDB Description: crystal structure of a190t mutant of human hippocalcin at 2.5 a resolution
PDB Compounds: (A:) Neuron-specific calcium-binding protein hippocalcin

SCOPe Domain Sequences for d5g58a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g58a_ a.39.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sklrpemlqdlrentefselelqewykgflkdcptgilnvdefkkiyanffpygdaskfa
ehvfrtfdtnsdgtidfrefiialsvtsrgrleqklmwafsmydldgngyisreemleiv
qaiykmvssvmkmpedestpekrtekifrqmdtnndgklsleefirgaksdpsivrllqc
dpss

SCOPe Domain Coordinates for d5g58a_:

Click to download the PDB-style file with coordinates for d5g58a_.
(The format of our PDB-style files is described here.)

Timeline for d5g58a_: