Lineage for d5g4pa_ (5g4p A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996349Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1996350Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1997730Family a.39.1.0: automated matches [191396] (1 protein)
    not a true family
  6. 1997731Protein automated matches [190513] (30 species)
    not a true protein
  7. 1997781Species Human (Homo sapiens) [TaxId:9606] [189519] (51 PDB entries)
  8. 1997817Domain d5g4pa_: 5g4p A: [333698]
    automated match to d2d8na_
    complexed with ca

Details for d5g4pa_

PDB Entry: 5g4p (more details), 2.42 Å

PDB Description: crystal structure of human hippocalcin at 2.4 a resolution
PDB Compounds: (A:) Neuron-specific calcium-binding protein hippocalcin

SCOPe Domain Sequences for d5g4pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g4pa_ a.39.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sklrpemlqdlrentefselelqewykgflkdcptgilnvdefkkiyanffpygdaskfa
ehvfrtfdtnsdgtidfrefiialsvtsrgrleqklmwafsmydldgngyisreemleiv
qaiykmvssvmkmpedestpekrtekifrqmdtnndgklsleefirgaksdpsivrllqc
dpss

SCOPe Domain Coordinates for d5g4pa_:

Click to download the PDB-style file with coordinates for d5g4pa_.
(The format of our PDB-style files is described here.)

Timeline for d5g4pa_: