SCOPe 2.08: Domain d5g4pa_: 5g4p A:

Lineage for d5g4pa_ (5g4p A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.0: automated matches [191396] (1 protein)
   not a true family

6. Protein automated matches [190513] (36 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189519] (58 PDB entries)

8. Domain d5g4pa_: 5g4p A: [333698]
   automated match to d2d8na_
   complexed with ca

Details for d5g4pa_

PDB Entry: 5g4p, 2.42 Å

PDB Description: crystal structure of human hippocalcin at 2.4 a resolution

PDB Compounds: (A:) Neuron-specific calcium-binding protein hippocalcin

SCOPe Domain Sequences for d5g4pa_:

Sequence; same for both SEQRES and ATOM records:

>d5g4pa_ a.39.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sklrpemlqdlrentefselelqewykgflkdcptgilnvdefkkiyanffpygdaskfa
ehvfrtfdtnsdgtidfrefiialsvtsrgrleqklmwafsmydldgngyisreemleiv
qaiykmvssvmkmpedestpekrtekifrqmdtnndgklsleefirgaksdpsivrllqc
dpss

Timeline for d5g4pa_:

• d5g4pa_ first appeared in SCOPe 2.06
  
• d5g4pa_ appears in SCOPe 2.07