Lineage for d5wx3c2 (5wx3 C:230-383)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2164457Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2164458Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2165221Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2165222Protein automated matches [196909] (60 species)
    not a true protein
  7. 2165948Species Tetradium ruticarpum [TaxId:354523] [333558] (5 PDB entries)
  8. 2165954Domain d5wx3c2: 5wx3 C:230-383 [333670]
    automated match to d3a5ra2
    complexed with coa, so4

Details for d5wx3c2

PDB Entry: 5wx3 (more details), 1.8 Å

PDB Description: alkyldiketide-coa synthase from evodia rutaecarpa
PDB Compounds: (C:) Alkyldiketide-CoA synthase

SCOPe Domain Sequences for d5wx3c2:

Sequence, based on SEQRES records: (download)

>d5wx3c2 c.95.1.0 (C:230-383) automated matches {Tetradium ruticarpum [TaxId: 354523]}
ifnivsanqttipdsedgivghiremgmkyylsrtvpqvignnivqccrdtftplgindw
nsmfyivhpggpavlrmmeeklglskermraswhvlseygnmwgpsvlfildemrnksme
egksttgeglewgvmfgfgpgltvetvvlrsvai

Sequence, based on observed residues (ATOM records): (download)

>d5wx3c2 c.95.1.0 (C:230-383) automated matches {Tetradium ruticarpum [TaxId: 354523]}
ifnivsanqttipdsedgivghiremgmkyylsrtvpqvimfyivhpggpavlrmmeekl
glskermraswhvlseygnmwgpsvlfildemrnksmeegksttgeglewgvmfgfgpgl
tvetvvlrsvai

SCOPe Domain Coordinates for d5wx3c2:

Click to download the PDB-style file with coordinates for d5wx3c2.
(The format of our PDB-style files is described here.)

Timeline for d5wx3c2: