SCOPe 2.08: Domain d5uwfc1: 5uwf C:449-768

Lineage for d5uwfc1 (5uwf C:449-768)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188676] (139 PDB entries)

8. Domain d5uwfc1: 5uwf C:449-768 [333667]
   Other proteins in same PDB: d5uwfc2, d5uwfd2
   automated match to d4ajmd_
   complexed with 8q7, mg, zn

Details for d5uwfc1

PDB Entry: 5uwf, 1.87 Å

PDB Description: crystal structure of human pde10a in complex with inhibitor 16d

PDB Compounds: (C:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d5uwfc1:

Sequence; same for both SEQRES and ATOM records:

>d5uwfc1 a.211.1.0 (C:449-768) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfelekl
crfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhr
gfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirk
aiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtklt
andiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilppt
epllkacrdnlsqwekvirg

Timeline for d5uwfc1:

• d5uwfc1 first appeared in SCOPe 2.06
  
• d5uwfc1 appears in SCOPe 2.07