Lineage for d5jhgb_ (5jhg B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2474875Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2475951Protein RhoA [52612] (1 species)
  7. 2475952Species Human (Homo sapiens) [TaxId:9606] [52613] (36 PDB entries)
    Uniprot P61586 2-181
  8. 2475998Domain d5jhgb_: 5jhg B: [333666]
    Other proteins in same PDB: d5jhga1, d5jhga2, d5jhge1, d5jhge2
    automated match to d4f38a_
    complexed with gol

Details for d5jhgb_

PDB Entry: 5jhg (more details), 2.5 Å

PDB Description: crystal structure of the complex between the human rhoa and the dh/ph domain of human arhgef11
PDB Compounds: (B:) transforming protein rhoa

SCOPe Domain Sequences for d5jhgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jhgb_ c.37.1.8 (B:) RhoA {Human (Homo sapiens) [TaxId: 9606]}
airkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdtag
qedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlr
ndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalq

SCOPe Domain Coordinates for d5jhgb_:

Click to download the PDB-style file with coordinates for d5jhgb_.
(The format of our PDB-style files is described here.)

Timeline for d5jhgb_: