Lineage for d1ekjc_ (1ekj C:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 71718Fold c.53: Resolvase-like [53040] (2 superfamilies)
  4. 71754Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (1 family) (S)
  5. 71755Family c.53.2.1: beta-carbonic anhydrase, cab [53057] (1 protein)
  6. 71756Protein beta-carbonic anhydrase [53058] (4 species)
  7. 71768Species Pea (Pisum sativum) [TaxId:3888] [53059] (1 PDB entry)
  8. 71771Domain d1ekjc_: 1ekj C: [33366]

Details for d1ekjc_

PDB Entry: 1ekj (more details), 1.93 Å

PDB Description: the x-ray crystallographic structure of beta carbonic anhydrase from the c3 dicot pisum sativum

SCOP Domain Sequences for d1ekjc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ekjc_ c.53.2.1 (C:) beta-carbonic anhydrase {Pea (Pisum sativum)}
sdgipkseaseriktgflhfkkekydknpalygelakgqsppfmvfacsdsrvcpshvld
fqpgeafvvrnvanlvppydqakyagtgaaieyavlhlkvsnivvighsacggikgllsf
pfdgtystdfieewvkiglpakakvkaqhgdapfaelcthcekeavnaslgnlltypfvr
eglvnktlalkggyydfvkgsfelwglefglsstfsv

SCOP Domain Coordinates for d1ekjc_:

Click to download the PDB-style file with coordinates for d1ekjc_.
(The format of our PDB-style files is described here.)

Timeline for d1ekjc_: