Lineage for d5vc2b_ (5vc2 B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470823Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2470824Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2472162Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2472163Protein automated matches [190151] (140 species)
    not a true protein
  7. 2472555Species Helicobacter pylori [TaxId:563041] [333652] (1 PDB entry)
  8. 2472557Domain d5vc2b_: 5vc2 B: [333653]
    automated match to d3pgya_

Details for d5vc2b_

PDB Entry: 5vc2 (more details), 1.9 Å

PDB Description: crystal structure of a serine hydroxymethyltransferase from helicobacter pylori
PDB Compounds: (B:) serine hydroxymethyltransferase

SCOPe Domain Sequences for d5vc2b_:

Sequence, based on SEQRES records: (download)

>d5vc2b_ c.67.1.0 (B:) automated matches {Helicobacter pylori [TaxId: 563041]}
ayfleqtdseifelifeeykrqnehlemiasenytfpsvmeamgsiltnkyaegypnkry
yggcevvdkieslaierakklfncqfanvqahsgsqannavyhallkpydkilgmdlscg
ghlthgakvsltgkhyqsfsygvnldgyidyeealkiaqsvkpeiivcgfsaypreidfk
kfreiadevgalllgdiahvaglvvtnehahpfphchvvsstthktlrgprggiiltnde
eiaakidkaifpgtqggplmhviaakavgfkenlkpefkayaklvksnmqvlakalkekn
hklvsggtsnhlllmdfldkpysgkdadialgnagitvnkntipgetrspfvtsgirigs
aalsargmgakefeiignkisdilndinnvslqlhvkeelkamanqfpvyqqpif

Sequence, based on observed residues (ATOM records): (download)

>d5vc2b_ c.67.1.0 (B:) automated matches {Helicobacter pylori [TaxId: 563041]}
ayfleqtdseifelifeeykrqnehlemiasenytfpsvmeamgsiltnkyavdkiesla
ierakklfncqfanvqahsgsqannavyhallkpydkilgmdgkhyqsfsygvnldgyid
yeealkiaqsvkpeiivcgfsaypreidfkkfreiadevgalllgdiahvaglvvtneha
hpfphchvvsstthktlrgprggiiltndeeiaakidkaifgplmhviaakavgfkenlk
pefkayaklvksnmqvlakalkeknhklvsggtsnhlllmdfldkpysgkdadialgnag
itvnkntipgetrspfvtsgirigsaalsargmgakefeiignkisdilndinnvslqlh
vkeelkamanqfpvyqqpif

SCOPe Domain Coordinates for d5vc2b_:

Click to download the PDB-style file with coordinates for d5vc2b_.
(The format of our PDB-style files is described here.)

Timeline for d5vc2b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5vc2a_