Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (83 species) not a true protein |
Species Tetradium ruticarpum [TaxId:354523] [333558] (5 PDB entries) |
Domain d5wx4a2: 5wx4 A:242-395 [333650] automated match to d3wd7a2 |
PDB Entry: 5wx4 (more details), 2.2 Å
SCOPe Domain Sequences for d5wx4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wx4a2 c.95.1.0 (A:242-395) automated matches {Tetradium ruticarpum [TaxId: 354523]} lfqvvscaeravpgtqdyikahlkemgmelhlstdvprmigknieklladavspfgisdw nslfyivhpgavaildqveenlglgedklrasryvlseygnmgaasvffildemrnksae egklttgeglewgvlfsfgpgltvetvvllsvpl
Timeline for d5wx4a2:
View in 3D Domains from other chains: (mouse over for more information) d5wx4b1, d5wx4b2, d5wx4c1, d5wx4c2 |