Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Paraburkholderia phymatum [TaxId:391038] [333644] (2 PDB entries) |
Domain d5va8a1: 5va8 A:1-259 [333647] Other proteins in same PDB: d5va8a2, d5va8b2, d5va8c2, d5va8d2 automated match to d5idxb_ complexed with mpo, nap, tce |
PDB Entry: 5va8 (more details), 1.6 Å
SCOPe Domain Sequences for d5va8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5va8a1 c.2.1.0 (A:1-259) automated matches {Paraburkholderia phymatum [TaxId: 391038]} mdlgiagksalvcaaskglgrgcaealaaegvnvtivartpetldataaairanagvdvq avacdittpegraaalaacpqpdilvnnaggpppgdfrnfthddwiraleanmltpieli ratidgmisrgfgrvvnitsssvkapidvlglsngarsgltgfiagvarkvapngvtinn llpgifdtdriavtfdaaakaqnisvdearkqrmatiparrfgtpdefgracaflcsvha gyitgqnwlidggaypgty
Timeline for d5va8a1: