SCOPe 2.06: Domain d5vijb_: 5vij B:

Lineage for d5vijb_ (5vij B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (140 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [186759] (101 PDB entries)

8. Domain d5vijb_: 5vij B: [333640]
   Other proteins in same PDB: d5vija_
   automated match to d4nf8b_
   complexed with 5dx, gly

Details for d5vijb_

PDB Entry: 5vij, 2.11 Å

PDB Description: crystal structure of glun1/glun2a nmda receptor agonist binding domains with glycine and antagonist, 4-bromophenyl-acepc

PDB Compounds: (B:) Glutamate receptor ionotropic, NMDA 2A

SCOPe Domain Sequences for d5vijb_:

Sequence; same for both SEQRES and ATOM records:

>d5vijb_ c.94.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dnhlsivtleeapfvivedidpltetcvrntvpcrkfvkinnstnegmnvkkcckgfcid
ilkklsrtvkftydlylvtngkhgkkvnnvwngmigevvyqravmavgsltineersevv
dfsvpfvetgisvmvsrgtqvtglsdkkfqrphdysppfrfgtvpngsternirnnypym
hqymtrfnqrgvedalvslktgkldafiydaavlnykagrdegcklvtigsgyifattgy
gialqkgspwkrqidlallqfvgdgemeeletlwltgich

Timeline for d5vijb_:

• d5vijb_ is new in SCOPe 2.06-stable
  
• d5vijb_ appears in SCOPe 2.07
  
• d5vijb_ appears in the current release, SCOPe 2.08