SCOPe 2.08: Domain d5wx3d2: 5wx3 D:230-383

Lineage for d5wx3d2 (5wx3 D:230-383)

Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

Fold c.95: Thiolase-like [53900] (1 superfamily)
consists of two similar domains related by pseudo dyad; duplication
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

Superfamily c.95.1: Thiolase-like [53901] (3 families)
Family c.95.1.0: automated matches [196908] (1 protein)
not a true family
Protein automated matches [196909] (83 species)
not a true protein
Species Tetradium ruticarpum [TaxId:354523] [333558] (5 PDB entries)
Domain d5wx3d2: 5wx3 D:230-383 [333634]
automated match to d3a5ra2
complexed with coa, so4

Details for d5wx3d2

PDB Entry: 5wx3 (more details), 1.8 Å

PDB Description: alkyldiketide-coa synthase from evodia rutaecarpa

PDB Compounds: (D:) Alkyldiketide-CoA synthase

SCOPe Domain Sequences for d5wx3d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wx3d2 c.95.1.0 (D:230-383) automated matches {Tetradium ruticarpum [TaxId: 354523]}
ifnivsanqttipdsedgivghiremgmkyylsrtvpqvignnivqccrdtftplgindw
nsmfyivhpggpavlrmmeeklglskermraswhvlseygnmwgpsvlfildemrnksme
egksttgeglewgvmfgfgpgltvetvvlrsvai

SCOPe Domain Coordinates for d5wx3d2:

Click to download the PDB-style file with coordinates for d5wx3d2.
(The format of our PDB-style files is described here.)

Timeline for d5wx3d2: