Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.120: PIN domain-like [88722] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.120.1: PIN domain-like [88723] (3 families) |
Family c.120.1.2: 5' to 3' exonuclease catalytic domain [53045] (4 proteins) contains an alpha-helical arch and additional strand 6 antiparallel to the rest; strand order 321456; similarity to the resolvase-like fold |
Protein Flap endonuclease-1 (Fen-1 nuclease) [53052] (5 species) |
Species Pyrococcus furiosus [TaxId:2261] [53055] (1 PDB entry) |
Domain d1b43b2: 1b43 B:1-219 [33363] Other proteins in same PDB: d1b43a1, d1b43b1 |
PDB Entry: 1b43 (more details), 2 Å
SCOPe Domain Sequences for d1b43b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b43b2 c.120.1.2 (B:1-219) Flap endonuclease-1 (Fen-1 nuclease) {Pyrococcus furiosus [TaxId: 2261]} gvpigeiiprkeielenlygkkiaidalnaiyqflstirqkdgtplmdskgritshlsgl fyrtinlmeagikpvyvfdgeppefkkkelekrreareeaeekwrealekgeieearkya qratrvnemliedakkllelmgipivqapsegeaqaaymaakgsvyasasqdydsllfga prlvrnltitgkrklpgknvyveikpeliileevlkelk
Timeline for d1b43b2: