SCOPe 2.03: Domain d1b43b2: 1b43 B:1-219

Lineage for d1b43b2 (1b43 B:1-219)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.120: PIN domain-like [88722] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.120.1: PIN domain-like [88723] (3 families)

5. Family c.120.1.2: 5' to 3' exonuclease catalytic domain [53045] (4 proteins)
   contains an alpha-helical arch and additional strand 6 antiparallel to the rest; strand order 321456; similarity to the resolvase-like fold

6. Protein Flap endonuclease-1 (Fen-1 nuclease) [53052] (5 species)

7. Species Pyrococcus furiosus [TaxId:2261] [53055] (1 PDB entry)

8. Domain d1b43b2: 1b43 B:1-219 [33363]
   Other proteins in same PDB: d1b43a1, d1b43b1

Details for d1b43b2

PDB Entry: 1b43, 2 Å

PDB Description: fen-1 from p. furiosus

PDB Compounds: (B:) protein (fen-1)

SCOPe Domain Sequences for d1b43b2:

Sequence; same for both SEQRES and ATOM records:

>d1b43b2 c.120.1.2 (B:1-219) Flap endonuclease-1 (Fen-1 nuclease) {Pyrococcus furiosus [TaxId: 2261]}
gvpigeiiprkeielenlygkkiaidalnaiyqflstirqkdgtplmdskgritshlsgl
fyrtinlmeagikpvyvfdgeppefkkkelekrreareeaeekwrealekgeieearkya
qratrvnemliedakkllelmgipivqapsegeaqaaymaakgsvyasasqdydsllfga
prlvrnltitgkrklpgknvyveikpeliileevlkelk

Timeline for d1b43b2:

• d1b43b2 first appeared (with stable ids) in SCOP 1.55
  
• d1b43b2 appears in SCOPe 2.02
  
• d1b43b2 appears in SCOPe 2.04
  
• d1b43b2 appears in the current release, SCOPe 2.08