Lineage for d1b43b2 (1b43 B:1-219)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 712940Fold c.120: PIN domain-like [88722] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145
  4. 712941Superfamily c.120.1: PIN domain-like [88723] (2 families) (S)
  5. 712997Family c.120.1.2: 5' to 3' exonuclease catalytic domain [53045] (4 proteins)
    contains an alpha-helical arch and additional strand 6 antiparallel to the rest; strand order 321456; similarity to the resolvase-like fold
  6. 713004Protein Flap endonuclease-1 (Fen-1 nuclease) [53052] (5 species)
  7. 713012Species Archaeon Pyrococcus furiosus [TaxId:2261] [53055] (1 PDB entry)
  8. 713014Domain d1b43b2: 1b43 B:1-219 [33363]
    Other proteins in same PDB: d1b43a1, d1b43b1

Details for d1b43b2

PDB Entry: 1b43 (more details), 2 Å

PDB Description: fen-1 from p. furiosus
PDB Compounds: (B:) protein (fen-1)

SCOP Domain Sequences for d1b43b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b43b2 c.120.1.2 (B:1-219) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Pyrococcus furiosus [TaxId: 2261]}
gvpigeiiprkeielenlygkkiaidalnaiyqflstirqkdgtplmdskgritshlsgl
fyrtinlmeagikpvyvfdgeppefkkkelekrreareeaeekwrealekgeieearkya
qratrvnemliedakkllelmgipivqapsegeaqaaymaakgsvyasasqdydsllfga
prlvrnltitgkrklpgknvyveikpeliileevlkelk

SCOP Domain Coordinates for d1b43b2:

Click to download the PDB-style file with coordinates for d1b43b2.
(The format of our PDB-style files is described here.)

Timeline for d1b43b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b43b1