Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
Fold c.53: Resolvase-like [53040] (2 superfamilies) |
Superfamily c.53.1: Resolvase-like [53041] (2 families) |
Family c.53.1.2: 5' to 3' exonuclease [53045] (5 proteins) |
Protein Fen-1 nuclease [53054] (1 species) |
Species Archaeon Pyrococcus furiosus [TaxId:2261] [53055] (1 PDB entry) |
Domain d1b43b2: 1b43 B:1-219 [33363] Other proteins in same PDB: d1b43a1, d1b43b1 |
PDB Entry: 1b43 (more details), 2 Å
SCOP Domain Sequences for d1b43b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b43b2 c.53.1.2 (B:1-219) Fen-1 nuclease {Archaeon Pyrococcus furiosus} gvpigeiiprkeielenlygkkiaidalnaiyqflstirqkdgtplmdskgritshlsgl fyrtinlmeagikpvyvfdgeppefkkkelekrreareeaeekwrealekgeieearkya qratrvnemliedakkllelmgipivqapsegeaqaaymaakgsvyasasqdydsllfga prlvrnltitgkrklpgknvyveikpeliileevlkelk
Timeline for d1b43b2: