![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
![]() | Protein automated matches [196909] (83 species) not a true protein |
![]() | Species Tetradium ruticarpum [TaxId:354523] [333558] (5 PDB entries) |
![]() | Domain d5wx7c2: 5wx7 C:230-384 [333621] automated match to d3a5ra2 complexed with coa, so4; mutant |
PDB Entry: 5wx7 (more details), 1.9 Å
SCOPe Domain Sequences for d5wx7c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wx7c2 c.95.1.0 (C:230-384) automated matches {Tetradium ruticarpum [TaxId: 354523]} ifnivsanqttipdsedgivghiremgmkyylsrtvpqvignnivqccrdtftplgindw nsmfyivhpggpavlrmmeeklglskermraswhvlseygnmggpsvlfildemrnksme egksttgeglewgvmfgfgpgltvetvvlrsvain
Timeline for d5wx7c2: