Class b: All beta proteins [48724] (178 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins) barrel, closed; n=8, S=12, meander |
Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [50836] (50 PDB entries) |
Domain d5kidb_: 5kid B: [333618] automated match to d1l6ma_ complexed with 7k9, cl, gol, so4, th |
PDB Entry: 5kid (more details), 2.15 Å
SCOPe Domain Sequences for d5kidb_:
Sequence, based on SEQRES records: (download)
>d5kidb_ b.60.1.1 (B:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]} sdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedksy nvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvffk kvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcid
>d5kidb_ b.60.1.1 (B:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]} sdlipapplskvplqqnfqdnqfqgkwyvvglagnailrpqkmyatiyelkedksynvts vlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvffkkvsq nreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcid
Timeline for d5kidb_: