SCOPe 2.07: Domain d5vihb_: 5vih B:

Lineage for d5vihb_ (5vih B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (158 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [186759] (113 PDB entries)

8. Domain d5vihb_: 5vih B: [333611]
   Other proteins in same PDB: d5viha_
   automated match to d4nf8b_
   complexed with 5dz, gly, peg

Details for d5vihb_

PDB Entry: 5vih, 2.4 Å

PDB Description: crystal structure of glun1/glun2a nmda receptor agonist binding domains with glycine and antagonist, 4-fluorophenyl-acepc

PDB Compounds: (B:) Glutamate receptor ionotropic, NMDA 2A

SCOPe Domain Sequences for d5vihb_:

Sequence, based on SEQRES records:

>d5vihb_ c.94.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dnhlsivtleeapfvivedidpltetcvrntvpcrkfvkinnstnegmnvkkcckgfcid
ilkklsrtvkftydlylvtngkhgkkvnnvwngmigevvyqravmavgsltineersevv
dfsvpfvetgisvmvsrgtqvtglsdkkfqrphdysppfrfgtvpngsternirnnypym
hqymtrfnqrgvedalvslktgkldafiydaavlnykagrdegcklvtigsgyifattgy
gialqkgspwkrqidlallqfvgdgemeeletlwltgich

Sequence, based on observed residues (ATOM records):

>d5vihb_ c.94.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dnhlsivtleeapfvivedidpltcvrntvpcrkfvkinnstnegmnvkkcckgfcidil
kklsrtvkftydlylvtngkhgkkvnnvwngmigevvyqravmavgsltineersevvdf
svpfvetgisvmvsrgtqvtglsdkkfqrphdysppfrfgtvpngsternirnnypymhq
ymtrfnqrgvedalvslktgkldafiydaavlnykagrdegcklvtigsgyifattgygi
alqkgspwkrqidlallqfvgdgemeeletlwltgich

Timeline for d5vihb_:

• d5vihb_ first appeared in SCOPe 2.06
  
• d5vihb_ appears in the current release, SCOPe 2.08