Lineage for d1a76_2 (1a76 2-208)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 496308Fold c.120: PIN domain-like [88722] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145
  4. 496309Superfamily c.120.1: PIN domain-like [88723] (2 families) (S)
  5. 496336Family c.120.1.2: 5' to 3' exonuclease catalytic domain [53045] (4 proteins)
    contains an alpha-helical arch and additional strand 6 antiparallel to the rest; strand order 321456; similarity to the resolvase-like fold
  6. 496343Protein Flap endonuclease-1 (Fen-1 nuclease) [53052] (4 species)
  7. 496348Species Archaeon Methanococcus jannaschii [TaxId:2190] [53053] (2 PDB entries)
  8. 496350Domain d1a76_2: 1a76 2-208 [33361]
    Other proteins in same PDB: d1a76_1

Details for d1a76_2

PDB Entry: 1a76 (more details), 2 Å

PDB Description: flap endonuclease-1 from methanococcus jannaschii

SCOP Domain Sequences for d1a76_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a76_2 c.120.1.2 (2-208) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Methanococcus jannaschii}
gvqfgdfipkniisfedlkgkkvaidgmnalyqfltsirlrdgsplrnrkgeitsayngv
fyktihllenditpiwvfdgeppklkektrkvrremkekaelkmkeaikkedfeeaakya
krvsyltpkmvenckyllslmgipyveapsegeaqasymakkgdvwavvsqdydallyga
prvvrnltttkempelielnevledlr

SCOP Domain Coordinates for d1a76_2:

Click to download the PDB-style file with coordinates for d1a76_2.
(The format of our PDB-style files is described here.)

Timeline for d1a76_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a76_1