Lineage for d1a76_2 (1a76 2-208)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.53: Resolvase-like [53040] (2 superfamilies) 
Superfamily c.53.1: Resolvase-like [53041] (2 families) 
Family c.53.1.2: 5' to 3' exonuclease [53045] (5 proteins) 
Protein Flap endonuclease-1 [53052] (1 species) Species Methanococcus jannaschii [TaxId:2190] [53053] (2 PDB entries) 
Domain d1a76_2: 1a76 2-208 [33361]
Other proteins in same PDB: d1a76_1
Details for d1a76_2
PDB Entry: 1a76 (more details), 2 Å
PDB Description: flap endonuclease-1 from methanococcus jannaschii
SCOP Domain Sequences for d1a76_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a76_2 c.53.1.2 (2-208) Flap endonuclease-1 {Methanococcus jannaschii}
gvqfgdfipkniisfedlkgkkvaidgmnalyqfltsirlrdgsplrnrkgeitsayngv
fyktihllenditpiwvfdgeppklkektrkvrremkekaelkmkeaikkedfeeaakya
krvsyltpkmvenckyllslmgipyveapsegeaqasymakkgdvwavvsqdydallyga
prvvrnltttkempelielnevledlr
SCOP Domain Coordinates for d1a76_2:
Click to download the PDB-style file with coordinates for d1a76_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a76_2:
- d1a76_2 appears in SCOP 1.57
- d1a76_2 appears in the current release, SCOPe 2.08, called d1a76a2
View in 3D
