Lineage for d1a76a2 (1a76 A:2-208)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921858Fold c.120: PIN domain-like [88722] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145
  4. 2921859Superfamily c.120.1: PIN domain-like [88723] (4 families) (S)
  5. 2921920Family c.120.1.2: 5' to 3' exonuclease catalytic domain [53045] (4 proteins)
    contains an alpha-helical arch and additional strand 6 antiparallel to the rest; strand order 321456; similarity to the resolvase-like fold
  6. 2921927Protein Flap endonuclease-1 (Fen-1 nuclease) [53052] (5 species)
  7. 2921936Species Methanococcus jannaschii [TaxId:2190] [53053] (2 PDB entries)
  8. 2921938Domain d1a76a2: 1a76 A:2-208 [33361]
    Other proteins in same PDB: d1a76a1
    complexed with mn
    missing some secondary structures that made up less than one-third of the common domain

Details for d1a76a2

PDB Entry: 1a76 (more details), 2 Å

PDB Description: flap endonuclease-1 from methanococcus jannaschii
PDB Compounds: (A:) flap endonuclease-1 protein

SCOPe Domain Sequences for d1a76a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a76a2 c.120.1.2 (A:2-208) Flap endonuclease-1 (Fen-1 nuclease) {Methanococcus jannaschii [TaxId: 2190]}
gvqfgdfipkniisfedlkgkkvaidgmnalyqfltsirlrdgsplrnrkgeitsayngv
fyktihllenditpiwvfdgeppklkektrkvrremkekaelkmkeaikkedfeeaakya
krvsyltpkmvenckyllslmgipyveapsegeaqasymakkgdvwavvsqdydallyga
prvvrnltttkempelielnevledlr

SCOPe Domain Coordinates for d1a76a2:

Click to download the PDB-style file with coordinates for d1a76a2.
(The format of our PDB-style files is described here.)

Timeline for d1a76a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a76a1