| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
| Family c.1.11.1: Enolase [51605] (2 proteins) automatically mapped to Pfam PF00113 |
| Protein automated matches [226973] (7 species) not a true protein |
| Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [333608] (1 PDB entry) |
| Domain d5wroa2: 5wro A:208-500 [333609] Other proteins in same PDB: d5wroa1, d5wroa3 automated match to d2xsxa2 complexed with cd, cl, co, gol, so4 |
PDB Entry: 5wro (more details), 2.02 Å
SCOPe Domain Sequences for d5wroa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wroa2 c.1.11.1 (A:208-500) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
keiilpvpafnvinggshagnklamqefmilptgatsfteamkmgsevyhhlknvikakf
gldatavgdeggfapniqsnkealnlisdaiakagytgkieigmdvaasefykdgqydld
fkneksdksqwlpadklanlyqefikdfpivsiedpfdqdhweawsnltgctdiqivgdd
ltvtnpkriatavekkacnclllkvnqigtvtesiaahllakkngwgtmvshrsgeteds
figdlvvglstgqiktgapcrserlakynqilrieeeigagvkfagksfrkpq
Timeline for d5wroa2: