Lineage for d5wroa1 (5wro A:69-207)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948256Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [333606] (1 PDB entry)
  8. 2948257Domain d5wroa1: 5wro A:69-207 [333607]
    Other proteins in same PDB: d5wroa2, d5wroa3
    automated match to d2xsxa1
    complexed with cd, cl, co, gol, so4

Details for d5wroa1

PDB Entry: 5wro (more details), 2.02 Å

PDB Description: crystal structure of drosophila enolase
PDB Compounds: (A:) enolase

SCOPe Domain Sequences for d5wroa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wroa1 d.54.1.0 (A:69-207) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
tikaikarqiydsrgnptvevdlttelglfraavpsgastgvhealelrdndkanyhgks
vlkavghvndtlgpelikanldvvdqasidnfmikldgtenkskfganailgvslavaka
gaakkgvplykhiadlagn

SCOPe Domain Coordinates for d5wroa1:

Click to download the PDB-style file with coordinates for d5wroa1.
(The format of our PDB-style files is described here.)

Timeline for d5wroa1: