SCOPe 2.07: Domain d1a77a2: 1a77 A:2-208

Lineage for d1a77a2 (1a77 A:2-208)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.120: PIN domain-like [88722] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.120.1: PIN domain-like [88723] (3 families)

5. Family c.120.1.2: 5' to 3' exonuclease catalytic domain [53045] (4 proteins)
   contains an alpha-helical arch and additional strand 6 antiparallel to the rest; strand order 321456; similarity to the resolvase-like fold

6. Protein Flap endonuclease-1 (Fen-1 nuclease) [53052] (5 species)

7. Species Methanococcus jannaschii [TaxId:2190] [53053] (2 PDB entries)

8. Domain d1a77a2: 1a77 A:2-208 [33360]
   Other proteins in same PDB: d1a77a1
   complexed with mg

Details for d1a77a2

PDB Entry: 1a77, 2 Å

PDB Description: flap endonuclease-1 from methanococcus jannaschii

PDB Compounds: (A:) flap endonuclease-1 protein

SCOPe Domain Sequences for d1a77a2:

Sequence; same for both SEQRES and ATOM records:

>d1a77a2 c.120.1.2 (A:2-208) Flap endonuclease-1 (Fen-1 nuclease) {Methanococcus jannaschii [TaxId: 2190]}
gvqfgdfipkniisfedlkgkkvaidgmnalyqfltsirlrdgsplrnrkgeitsayngv
fyktihllenditpiwvfdgeppklkektrkvrremkekaelkmkeaikkedfeeaakya
krvsyltpkmvenckyllslmgipyveapsegeaqasymakkgdvwavvsqdydallyga
prvvrnltttkempelielnevledlr

Timeline for d1a77a2:

• d1a77a2 first appeared (with stable ids) in SCOP 1.55, called d1a77_2
  
• d1a77a2 appears in SCOPe 2.06
  
• d1a77a2 appears in the current release, SCOPe 2.08