SCOP 1.69: Domain d1a77_2: 1a77 2-208

Lineage for d1a77_2 (1a77 2-208)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.120: PIN domain-like [88722] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.120.1: PIN domain-like [88723] (2 families)

5. Family c.120.1.2: 5' to 3' exonuclease catalytic domain [53045] (4 proteins)
   contains an alpha-helical arch and additional strand 6 antiparallel to the rest; strand order 321456; similarity to the resolvase-like fold

6. Protein Flap endonuclease-1 (Fen-1 nuclease) [53052] (4 species)

7. Species Archaeon Methanococcus jannaschii [TaxId:2190] [53053] (2 PDB entries)

8. Domain d1a77_2: 1a77 2-208 [33360]
   Other proteins in same PDB: d1a77_1

Details for d1a77_2

PDB Entry: 1a77, 2 Å

PDB Description: flap endonuclease-1 from methanococcus jannaschii

SCOP Domain Sequences for d1a77_2:

Sequence; same for both SEQRES and ATOM records:

>d1a77_2 c.120.1.2 (2-208) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Methanococcus jannaschii}
gvqfgdfipkniisfedlkgkkvaidgmnalyqfltsirlrdgsplrnrkgeitsayngv
fyktihllenditpiwvfdgeppklkektrkvrremkekaelkmkeaikkedfeeaakya
krvsyltpkmvenckyllslmgipyveapsegeaqasymakkgdvwavvsqdydallyga
prvvrnltttkempelielnevledlr

Timeline for d1a77_2:

• d1a77_2 first appeared (with stable ids) in SCOP 1.55
  
• d1a77_2 appears in SCOP 1.67
  
• d1a77_2 appears in SCOP 1.71
  
• d1a77_2 appears in the current release, SCOPe 2.08, called d1a77a2