Lineage for d1a77_2 (1a77 2-208)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24949Fold c.53: Resolvase-like [53040] (2 superfamilies)
  4. 24950Superfamily c.53.1: Resolvase-like [53041] (2 families) (S)
  5. 24960Family c.53.1.2: 5' to 3' exonuclease [53045] (5 proteins)
  6. 24971Protein Flap endonuclease-1 [53052] (1 species)
  7. 24972Species Methanococcus jannaschii [TaxId:2190] [53053] (2 PDB entries)
  8. 24973Domain d1a77_2: 1a77 2-208 [33360]
    Other proteins in same PDB: d1a77_1

Details for d1a77_2

PDB Entry: 1a77 (more details), 2 Å

PDB Description: flap endonuclease-1 from methanococcus jannaschii

SCOP Domain Sequences for d1a77_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a77_2 c.53.1.2 (2-208) Flap endonuclease-1 {Methanococcus jannaschii}
gvqfgdfipkniisfedlkgkkvaidgmnalyqfltsirlrdgsplrnrkgeitsayngv
fyktihllenditpiwvfdgeppklkektrkvrremkekaelkmkeaikkedfeeaakya
krvsyltpkmvenckyllslmgipyveapsegeaqasymakkgdvwavvsqdydallyga
prvvrnltttkempelielnevledlr

SCOP Domain Coordinates for d1a77_2:

Click to download the PDB-style file with coordinates for d1a77_2.
(The format of our PDB-style files is described here.)

Timeline for d1a77_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a77_1