Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.120: PIN domain-like [88722] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.120.1: PIN domain-like [88723] (4 families) |
Family c.120.1.2: 5' to 3' exonuclease catalytic domain [53045] (4 proteins) contains an alpha-helical arch and additional strand 6 antiparallel to the rest; strand order 321456; similarity to the resolvase-like fold |
Protein Flap endonuclease-1 (Fen-1 nuclease) [53052] (5 species) |
Species Methanococcus jannaschii [TaxId:2190] [53053] (2 PDB entries) |
Domain d1a77a2: 1a77 A:2-208 [33360] Other proteins in same PDB: d1a77a1 complexed with mg missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 1a77 (more details), 2 Å
SCOPe Domain Sequences for d1a77a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a77a2 c.120.1.2 (A:2-208) Flap endonuclease-1 (Fen-1 nuclease) {Methanococcus jannaschii [TaxId: 2190]} gvqfgdfipkniisfedlkgkkvaidgmnalyqfltsirlrdgsplrnrkgeitsayngv fyktihllenditpiwvfdgeppklkektrkvrremkekaelkmkeaikkedfeeaakya krvsyltpkmvenckyllslmgipyveapsegeaqasymakkgdvwavvsqdydallyga prvvrnltttkempelielnevledlr
Timeline for d1a77a2: