SCOPe 2.08: Domain d5wx6c2: 5wx6 C:230-383

Lineage for d5wx6c2 (5wx6 C:230-383)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (83 species)
   not a true protein

7. Species Tetradium ruticarpum [TaxId:354523] [333558] (5 PDB entries)

8. Domain d5wx6c2: 5wx6 C:230-383 [333598]
   automated match to d3a5ra2
   complexed with coa, so4; mutant

Details for d5wx6c2

PDB Entry: 5wx6, 1.8 Å

PDB Description: alkyldiketide-coa synthase w332q mutant from evodia rutaecarpa

PDB Compounds: (C:) Alkyldiketide-CoA synthase

SCOPe Domain Sequences for d5wx6c2:

Sequence, based on SEQRES records:

>d5wx6c2 c.95.1.0 (C:230-383) automated matches {Tetradium ruticarpum [TaxId: 354523]}
ifnivsanqttipdsedgivghiremgmkyylsrtvpqvignnivqccrdtftplgindw
nsmfyivhpggpavlrmmeeklglskermraswhvlseygnmqgpsvlfildemrnksme
egksttgeglewgvmfgfgpgltvetvvlrsvai

Sequence, based on observed residues (ATOM records):

>d5wx6c2 c.95.1.0 (C:230-383) automated matches {Tetradium ruticarpum [TaxId: 354523]}
ifnivsanqttipdsedgivghiremgmkyylsrtvpqvignnivqccrdtfwnsmfyiv
hpggpavlrmmeeklglskermraswhvlseygnmqgpsvlfildemrnksmeegksttg
eglewgvmfgfgpgltvetvvlrsvai

Timeline for d5wx6c2:

• d5wx6c2 first appeared in SCOPe 2.06
  
• d5wx6c2 appears in SCOPe 2.07