Lineage for d5vgma1 (5vgm A:1-342)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2419618Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2420241Family c.1.9.0: automated matches [191327] (1 protein)
    not a true family
  6. 2420242Protein automated matches [190150] (26 species)
    not a true protein
  7. 2420443Species Vibrio cholerae [TaxId:666] [333555] (1 PDB entry)
  8. 2420444Domain d5vgma1: 5vgm A:1-342 [333585]
    Other proteins in same PDB: d5vgma2, d5vgmb2
    automated match to d4lfyb_
    complexed with act, cl, zn

Details for d5vgma1

PDB Entry: 5vgm (more details), 1.95 Å

PDB Description: crystal structure of dihydroorotase pyrc from vibrio cholerae in complex with zinc at 1.95 a resolution.
PDB Compounds: (A:) dihydroorotase

SCOPe Domain Sequences for d5vgma1:

Sequence, based on SEQRES records: (download)

>d5vgma1 c.1.9.0 (A:1-342) automated matches {Vibrio cholerae [TaxId: 666]}
mttltitrpddwhvhlrdgdvladtvrdisryngralimpntvppvtttemalayrerim
aaqpqahfeplmalyltdntspeeirkakasgkvvaaklypagattnsdsgvtsakniyp
vlqamqevgmlllvhgevtthevdifdrektfldtvlapivndfpqlkivlehittadav
tfvqqagdnvaatitahhllfnrnhmlvggirphfyclpilkrathqhalvaaatsgskk
fflgtdsaphakgrkeaacgcagsytahaalelyaevfekegklenleafasfngpdfyg
lprnqetvtltkqawpvaesmpfgsdivvpirageniewtvk

Sequence, based on observed residues (ATOM records): (download)

>d5vgma1 c.1.9.0 (A:1-342) automated matches {Vibrio cholerae [TaxId: 666]}
mttltitrpddwhvhlrdgdvladtvrdisryngralimpntvppvtttemalayrerim
aaqhfeplmalyltdntspeeirkakasgkvvaaklypgvtsakniypvlqamqevgmll
lvhgevtthevdifdrektfldtvlapivndfpqlkivlehittadavtfvqqagdnvaa
titahhllfnrnhmlvggirphfyclpilkrathqhalvaaatsgskkfflgtdsaphak
grkeaacgcagsytahaalelyaevfekegklenleafasfngpdfyglprnqetvtltk
qawpvaesmpfgsdivvpirageniewtvk

SCOPe Domain Coordinates for d5vgma1:

Click to download the PDB-style file with coordinates for d5vgma1.
(The format of our PDB-style files is described here.)

Timeline for d5vgma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5vgma2