SCOPe 2.08: Domain d5ni0e_: 5ni0 E:

Lineage for d5ni0e_ (5ni0 E:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families)

5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)

6. Protein automated matches [190079] (12 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [189349] (76 PDB entries)

8. Domain d5ni0e_: 5ni0 E: [333584]
   automated match to d5a87b_
   complexed with 8xw, zn

Details for d5ni0e_

PDB Entry: 5ni0, 1.67 Å

PDB Description: vim-2_10c. metallo-beta-lactamase inhibitors by bioisosteric replacement: preparation, activity and binding

PDB Compounds: (E:) beta-lactamase class b vim-2

SCOPe Domain Sequences for d5ni0e_:

Sequence; same for both SEQRES and ATOM records:

>d5ni0e_ d.157.1.1 (E:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
eyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn
taallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegneip
thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsagnv
adadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkaht

Timeline for d5ni0e_:

• d5ni0e_ first appeared in SCOPe 2.06
  
• d5ni0e_ appears in SCOPe 2.07