Lineage for d5jhge1 (5jhg E:714-941)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719559Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily)
    multihelical; core: 5-helical bundle
  4. 2719560Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (2 families) (S)
    automatically mapped to Pfam PF00621
  5. 2719561Family a.87.1.1: DBL homology domain (DH-domain) [48066] (10 proteins)
    Pfam PF00621
  6. 2719589Protein Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF [116957] (1 species)
  7. 2719590Species Human (Homo sapiens) [TaxId:9606] [116958] (5 PDB entries)
    Uniprot O15085 714-1081
  8. 2719598Domain d5jhge1: 5jhg E:714-941 [333580]
    Other proteins in same PDB: d5jhga2, d5jhgb_, d5jhge2, d5jhgf_
    automated match to d1xcga1
    complexed with gol

Details for d5jhge1

PDB Entry: 5jhg (more details), 2.5 Å

PDB Description: crystal structure of the complex between the human rhoa and the dh/ph domain of human arhgef11
PDB Compounds: (E:) Rho guanine nucleotide exchange factor 11

SCOPe Domain Sequences for d5jhge1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jhge1 a.87.1.1 (E:714-941) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]}
qnwqhtvgkdvvagltqreidrqevinelfvteashlrtlrvldlifyqrmkkenlmpre
elarlfpnlpelieihnswceamkklreegpiikeisdlmlarfdgpareelqqvaaqfc
syqsialeliktkqrkesrfqlfmqeaeshpqcrrlqlrdliisemqrltkyplllesii
khteggtseheklcrardqcreilkyvneavkqtenrhrlegyqkrld

SCOPe Domain Coordinates for d5jhge1:

Click to download the PDB-style file with coordinates for d5jhge1.
(The format of our PDB-style files is described here.)

Timeline for d5jhge1: