![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily) multihelical; core: 5-helical bundle |
![]() | Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (2 families) ![]() automatically mapped to Pfam PF00621 |
![]() | Family a.87.1.1: DBL homology domain (DH-domain) [48066] (10 proteins) Pfam PF00621 |
![]() | Protein Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF [116957] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [116958] (5 PDB entries) Uniprot O15085 714-1081 |
![]() | Domain d5jhge1: 5jhg E:714-941 [333580] Other proteins in same PDB: d5jhga2, d5jhgb_, d5jhge2, d5jhgf_ automated match to d1xcga1 complexed with gol |
PDB Entry: 5jhg (more details), 2.5 Å
SCOPe Domain Sequences for d5jhge1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jhge1 a.87.1.1 (E:714-941) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} qnwqhtvgkdvvagltqreidrqevinelfvteashlrtlrvldlifyqrmkkenlmpre elarlfpnlpelieihnswceamkklreegpiikeisdlmlarfdgpareelqqvaaqfc syqsialeliktkqrkesrfqlfmqeaeshpqcrrlqlrdliisemqrltkyplllesii khteggtseheklcrardqcreilkyvneavkqtenrhrlegyqkrld
Timeline for d5jhge1:
![]() Domains from other chains: (mouse over for more information) d5jhga1, d5jhga2, d5jhgb_, d5jhgf_ |