Lineage for d5wx7a1 (5wx7 A:9-229)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2918314Species Tetradium ruticarpum [TaxId:354523] [333558] (5 PDB entries)
  8. 2918331Domain d5wx7a1: 5wx7 A:9-229 [333577]
    automated match to d3a5ra1
    complexed with coa, so4; mutant

Details for d5wx7a1

PDB Entry: 5wx7 (more details), 1.9 Å

PDB Description: alkyldiketide-coa synthase w332g mutant from evodia rutaecarpa
PDB Compounds: (A:) Alkyldiketide-CoA synthase

SCOPe Domain Sequences for d5wx7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wx7a1 c.95.1.0 (A:9-229) automated matches {Tetradium ruticarpum [TaxId: 354523]}
qaavlaiatanppnifyqadypdfyfrvtksehmtqlkdkfkrmceksmirkrhmylted
vikenpnigilnapsfnarqeimveevpklgkeaalkaikewgqplsklthlifctssgv
nmpsadyhlakimglppyvqrtmiyqqgcfagatalrlakdiaenngghtrilivcvelm
vvcfqapsdtyldllvgnaifsdgaaaaivgadldttterp

SCOPe Domain Coordinates for d5wx7a1:

Click to download the PDB-style file with coordinates for d5wx7a1.
(The format of our PDB-style files is described here.)

Timeline for d5wx7a1: