Lineage for d5virb_ (5vir B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2442470Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2442471Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2443142Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2443143Protein automated matches [190459] (52 species)
    not a true protein
  7. 2443293Species Mycobacterium abscessus [TaxId:561007] [312100] (12 PDB entries)
  8. 2443310Domain d5virb_: 5vir B: [333566]
    automated match to d4ymib_
    complexed with 9cg, nap

Details for d5virb_

PDB Entry: 5vir (more details), 1.7 Å

PDB Description: crystal structure of probable nicotinate-nucleotide adenylyltransferase from mycobacterium abscessus in complex with nadp and compound fol0091
PDB Compounds: (B:) Probable nicotinate-nucleotide adenylyltransferase

SCOPe Domain Sequences for d5virb_:

Sequence, based on SEQRES records: (download)

>d5virb_ c.26.1.0 (B:) automated matches {Mycobacterium abscessus [TaxId: 561007]}
rrrlgvmggtfdpihnghlvaasevadrfaldevifvptgqpwqkqgrkvspaehrylmt
viatasnprftvsradidrggatytvdtltdlrtahpdadlyfitgadalasilswenwe
qlftlakfigvsrpgyelssdhiahaelppdglslvevpalaisstdcriragqarpiwy
lvpdgvvqyvakhrlys

Sequence, based on observed residues (ATOM records): (download)

>d5virb_ c.26.1.0 (B:) automated matches {Mycobacterium abscessus [TaxId: 561007]}
rrrlgvmggtfdpihnghlvaasevadrfaldevifvptgqpwqkqrkvspaehrylmtv
iatasnprftvsradidrggatytvdtltdlrtahpdadlyfitgadalasilswenweq
lftlakfigvsrpgyelssdhiahaelppdglslvevpalaisstdcriragqarpiwyl
vpdgvvqyvakhrlys

SCOPe Domain Coordinates for d5virb_:

Click to download the PDB-style file with coordinates for d5virb_.
(The format of our PDB-style files is described here.)

Timeline for d5virb_: