Lineage for d1taua2 (1tau A:10-173)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1885042Fold c.120: PIN domain-like [88722] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145
  4. 1885043Superfamily c.120.1: PIN domain-like [88723] (3 families) (S)
  5. 1885099Family c.120.1.2: 5' to 3' exonuclease catalytic domain [53045] (4 proteins)
    contains an alpha-helical arch and additional strand 6 antiparallel to the rest; strand order 321456; similarity to the resolvase-like fold
  6. 1885100Protein 5' to 3' exonuclease domain of DNA polymerase Taq [53048] (1 species)
  7. 1885101Species Thermus aquaticus [TaxId:271] [53049] (3 PDB entries)
  8. 1885104Domain d1taua2: 1tau A:10-173 [33355]
    Other proteins in same PDB: d1taua1, d1taua3, d1taua4
    protein/DNA complex; complexed with bgl, zn

Details for d1taua2

PDB Entry: 1tau (more details), 3 Å

PDB Description: taq polymerase (e.c.2.7.7.7)/dna/b-octylglucoside complex
PDB Compounds: (A:) protein (taq polymerase)

SCOPe Domain Sequences for d1taua2:

Sequence, based on SEQRES records: (download)

>d1taua2 c.120.1.2 (A:10-173) 5' to 3' exonuclease domain of DNA polymerase Taq {Thermus aquaticus [TaxId: 271]}
pkgrvllvdghhlayrtfhalkglttsrgepvqavygfaksllkalkedgdavivvfdak
apsfrheayggykagraptpedfprqlalikelvdllglarlevpgyeaddvlaslakka
ekegyevriltadkdlyqllsdrihvlhpegylitpawlwekyg

Sequence, based on observed residues (ATOM records): (download)

>d1taua2 c.120.1.2 (A:10-173) 5' to 3' exonuclease domain of DNA polymerase Taq {Thermus aquaticus [TaxId: 271]}
pkgrvllvdghhlayrtfhalkglttsrgepvqavygfaksllkalkedgdavivvfdar
aptpedfprqlalikelvdllglarlevpgyeaddvlaslakkaekegyevriltadkdl
yqllsdrihvlhpegylitpawlwekyg

SCOPe Domain Coordinates for d1taua2:

Click to download the PDB-style file with coordinates for d1taua2.
(The format of our PDB-style files is described here.)

Timeline for d1taua2: