SCOP 1.65: Domain d1taua2: 1tau A:10-173

Lineage for d1taua2 (1tau A:10-173)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.120: PIN domain-like [88722] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.120.1: PIN domain-like [88723] (2 families)

5. Family c.120.1.2: 5' to 3' exonuclease catalytic domain [53045] (4 proteins)
   contains an alpha-helical arch and additional strand 6 antiparallel to the rest; strand order 321456; similarity to the resolvase-like fold

6. Protein 5' to 3' exonuclease domain of DNA polymerase Taq [53048] (1 species)

7. Species Thermus aquaticus [TaxId:271] [53049] (4 PDB entries)

8. Domain d1taua2: 1tau A:10-173 [33355]
   Other proteins in same PDB: d1taua1, d1taua3, d1taua4
   protein/DNA complex; complexed with bgl, zn

Details for d1taua2

PDB Entry: 1tau, 3 Å

PDB Description: taq polymerase (e.c.2.7.7.7)/dna/b-octylglucoside complex

SCOP Domain Sequences for d1taua2:

Sequence, based on SEQRES records:

>d1taua2 c.120.1.2 (A:10-173) 5' to 3' exonuclease domain of DNA polymerase Taq {Thermus aquaticus}
pkgrvllvdghhlayrtfhalkglttsrgepvqavygfaksllkalkedgdavivvfdak
apsfrheayggykagraptpedfprqlalikelvdllglarlevpgyeaddvlaslakka
ekegyevriltadkdlyqllsdrihvlhpegylitpawlwekyg

Sequence, based on observed residues (ATOM records):

>d1taua2 c.120.1.2 (A:10-173) 5' to 3' exonuclease domain of DNA polymerase Taq {Thermus aquaticus}
pkgrvllvdghhlayrtfhalkglttsrgepvqavygfaksllkalkedgdavivvfdar
aptpedfprqlalikelvdllglarlevpgyeaddvlaslakkaekegyevriltadkdl
yqllsdrihvlhpegylitpawlwekyg

Timeline for d1taua2:

• d1taua2 first appeared (with stable ids) in SCOP 1.55
  
• d1taua2 appears in SCOP 1.63
  
• d1taua2 appears in SCOP 1.67
  
• d1taua2 appears in the current release, SCOPe 2.08