SCOP 1.57: Domain d1taua2: 1tau A:10-173

Lineage for d1taua2 (1tau A:10-173)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.53: Resolvase-like [53040] (2 superfamilies)

4. Superfamily c.53.1: Resolvase-like [53041] (2 families)

5. Family c.53.1.2: 5' to 3' exonuclease [53045] (5 proteins)

6. Protein 5' to 3' exonuclease domain of DNA polymerase Taq [53048] (1 species)

7. Species Thermus aquaticus [TaxId:271] [53049] (4 PDB entries)

8. Domain d1taua2: 1tau A:10-173 [33355]
   Other proteins in same PDB: d1taua1, d1taua3, d1taua4

Details for d1taua2

PDB Entry: 1tau, 3 Å

PDB Description: taq polymerase (e.c.2.7.7.7)/dna/b-octylglucoside complex

SCOP Domain Sequences for d1taua2:

Sequence, based on SEQRES records:

>d1taua2 c.53.1.2 (A:10-173) 5' to 3' exonuclease domain of DNA polymerase Taq {Thermus aquaticus}
pkgrvllvdghhlayrtfhalkglttsrgepvqavygfaksllkalkedgdavivvfdak
apsfrheayggykagraptpedfprqlalikelvdllglarlevpgyeaddvlaslakka
ekegyevriltadkdlyqllsdrihvlhpegylitpawlwekyg

Sequence, based on observed residues (ATOM records):

>d1taua2 c.53.1.2 (A:10-173) 5' to 3' exonuclease domain of DNA polymerase Taq {Thermus aquaticus}
pkgrvllvdghhlayrtfhalkglttsrgepvqavygfaksllkalkedgdavivvfdar
aptpedfprqlalikelvdllglarlevpgyeaddvlaslakkaekegyevriltadkdl
yqllsdrihvlhpegylitpawlwekyg

Timeline for d1taua2:

• d1taua2 first appeared (with stable ids) in SCOP 1.55
  
• d1taua2 appears in SCOP 1.59
  
• d1taua2 appears in the current release, SCOPe 2.08