| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.1: Truncated hemoglobin [46459] (2 proteins) lack the first helix (A) |
| Protein automated matches [190322] (4 species) not a true protein |
| Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [333034] (3 PDB entries) |
| Domain d5v3ua_: 5v3u A: [333546] automated match to d2bkma_ complexed with cyn, hem, so4; mutant |
PDB Entry: 5v3u (more details), 2.5 Å
SCOPe Domain Sequences for d5v3ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5v3ua_ a.1.1.1 (A:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
skqpmtpfeaiggeqcieilvdtfysyvskhpdlspifpddltetarkqkqfltqylggp
nlyteehghpmlrarhlpfeitpkraeallscmeqamddtgvhghirefvferlaltaqh
mvntpnetgei
Timeline for d5v3ua_: