SCOP 1.57: Domain d1cmwa2: 1cmw A:10-173

Lineage for d1cmwa2 (1cmw A:10-173)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.53: Resolvase-like [53040] (2 superfamilies)

4. Superfamily c.53.1: Resolvase-like [53041] (2 families)

5. Family c.53.1.2: 5' to 3' exonuclease [53045] (5 proteins)

6. Protein 5' to 3' exonuclease domain of DNA polymerase Taq [53048] (1 species)

7. Species Thermus aquaticus [TaxId:271] [53049] (4 PDB entries)

8. Domain d1cmwa2: 1cmw A:10-173 [33354]
   Other proteins in same PDB: d1cmwa1, d1cmwa3, d1cmwa4

Details for d1cmwa2

PDB Entry: 1cmw, 2.6 Å

PDB Description: crystal structure of taq dna-polymerase shows a new orientation for the structure-specific nuclease domain

SCOP Domain Sequences for d1cmwa2:

Sequence; same for both SEQRES and ATOM records:

>d1cmwa2 c.53.1.2 (A:10-173) 5' to 3' exonuclease domain of DNA polymerase Taq {Thermus aquaticus}
pkgrvllvdghhlayrtfhalkglttsrgepvqavygfaksllkalkedgdavivvfdak
apsfrheayggykagraptpedfprqlalikelvdllglarlevpgyeaddvlaslakka
ekegyevriltadkdlyqllsdrihvlhpegylitpawlwekyg

Timeline for d1cmwa2:

• d1cmwa2 first appeared (with stable ids) in SCOP 1.55
  
• d1cmwa2 appears in SCOP 1.59
  
• d1cmwa2 last appears in SCOP 1.75