Lineage for d1cmwa2 (1cmw A:10-173)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24949Fold c.53: Resolvase-like [53040] (2 superfamilies)
  4. 24950Superfamily c.53.1: Resolvase-like [53041] (2 families) (S)
  5. 24960Family c.53.1.2: 5' to 3' exonuclease [53045] (5 proteins)
  6. 24961Protein 5' to 3' exonuclease domain of DNA polymerase Taq [53048] (1 species)
  7. 24962Species Thermus aquaticus [TaxId:271] [53049] (4 PDB entries)
  8. 24964Domain d1cmwa2: 1cmw A:10-173 [33354]
    Other proteins in same PDB: d1cmwa1, d1cmwa3, d1cmwa4

Details for d1cmwa2

PDB Entry: 1cmw (more details), 2.6 Å

PDB Description: crystal structure of taq dna-polymerase shows a new orientation for the structure-specific nuclease domain

SCOP Domain Sequences for d1cmwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cmwa2 c.53.1.2 (A:10-173) 5' to 3' exonuclease domain of DNA polymerase Taq {Thermus aquaticus}
pkgrvllvdghhlayrtfhalkglttsrgepvqavygfaksllkalkedgdavivvfdak
apsfrheayggykagraptpedfprqlalikelvdllglarlevpgyeaddvlaslakka
ekegyevriltadkdlyqllsdrihvlhpegylitpawlwekyg

SCOP Domain Coordinates for d1cmwa2:

Click to download the PDB-style file with coordinates for d1cmwa2.
(The format of our PDB-style files is described here.)

Timeline for d1cmwa2: