Lineage for d5t8ea_ (5t8e A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2728287Protein Androgen receptor [63621] (4 species)
  7. 2728297Species Human (Homo sapiens) [TaxId:9606] [63623] (65 PDB entries)
    Uniprot P10275 671-919
  8. 2728362Domain d5t8ea_: 5t8e A: [333531]
    automated match to d1xj7a_
    complexed with 77u, gol

Details for d5t8ea_

PDB Entry: 5t8e (more details), 2.71 Å

PDB Description: synthesis and biological evaluation of novel selective androgen receptor modulators (sarms). part ii: optimization of 4-(pyrrolidin- 1-yl)benzonitrile derivatives
PDB Compounds: (A:) Androgen receptor

SCOPe Domain Sequences for d5t8ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t8ea_ a.123.1.1 (A:) Androgen receptor {Human (Homo sapiens) [TaxId: 9606]}
piflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlhv
ddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrhl
sqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrknpt
scsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkilsgk
vkpiyfhtq

SCOPe Domain Coordinates for d5t8ea_:

Click to download the PDB-style file with coordinates for d5t8ea_.
(The format of our PDB-style files is described here.)

Timeline for d5t8ea_: